PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_62361g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 331aa    MW: 37254.5 Da    PI: 4.6479
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_62361g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.27.7e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv+ ++++G g+W+ +++  g+ R++k+c++rw +yl
    MA_62361g0010 14 KGPWTAEEDRKLVNFITMHGHGCWREVPKLAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding44.24.6e-1470110446
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       ++ E++l++d+++  G++ W++Ia+ ++ gRt++++k++w++
    MA_62361g0010  70 LSESEEKLIIDLHAAIGNR-WSRIAAQLP-GRTDNEIKNYWNT 110
                      5899***************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-23563IPR009057Homeodomain-like
PROSITE profilePS5129423.939965IPR017930Myb domain
SuperFamilySSF466891.87E-2811108IPR009057Homeodomain-like
SMARTSM007172.1E-141363IPR001005SANT/Myb domain
PfamPF002491.3E-151461IPR001005SANT/Myb domain
CDDcd001672.27E-111661No hitNo description
Gene3DG3DSA:1.10.10.607.1E-2464116IPR009057Homeodomain-like
PROSITE profilePS5129418.67166116IPR017930Myb domain
SMARTSM007177.6E-1366114IPR001005SANT/Myb domain
PfamPF002491.1E-1270110IPR001005SANT/Myb domain
CDDcd001671.07E-971110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAE EDRKLVNFIT MHGHGCWREV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SESEEKLIID LHAAIGNRWS RIAAQLPGRT DNEIKNYWNT RIKKKLRQMG  120
IDPVTHKPLS QMQMQSSPTQ SLLLQENDEQ QQQQQQQNEP DQNHSNGSAE TLVLTAREPN  180
DDIEPLENFN MEDSMQLFNV CSPTSVISLS GRTEEVDSDD SDQVSKSFGN GGHAQYIGRE  240
SSGVKAECGL SVWDQMGGVL GDPLSDYNSQ WNVDLESWTA GLDAHAASAS AWIQQLPDCQ  300
WNDFQGDFEI CSKSCPETLQ RLGPFLDDDE M
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1110116RIKKKLR
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0839120.0EF083912.1 Picea sitchensis clone WS0283_G14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010528552.12e-82PREDICTED: protein ODORANT1-like
SwissprotQ50EX61e-77ODO1_PETHY; Protein ODORANT1
TrEMBLA9NRI40.0A9NRI4_PICSI; Putative uncharacterized protein
STRINGGLYMA11G33620.18e-81(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.19e-77myb domain protein 20